PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G25830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 740aa    MW: 84358.4 Da    PI: 6.5877
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G25830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS334.81.6e-1023607321374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+avs ++++la+ +L+ ++++asp+gd  qRla +++  L  rl++++s++y+++ +++ +   +++ l+++++   ++P+l+ s
  ORUFI03G25830.1 360 LRTLLINCAQAVSVSNHSLASDILKIIRHHASPTGDDSQRLALCLAYCLDVRLTGTGSQIYHKFITKRRN---VKDILKVFHVCLSTCPFLRAS 450
                      6789*********************************************************999998887...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      h   N++I++  +g+ +vHiiDf+i  G+QWp+L+++La+ ++gpp+lRiTg++ pesg     + +++g rLa++A+++++pfe++ + ++++
  ORUFI03G25830.1 451 HYFSNRTIVDVSKGKPQVHIIDFGICFGFQWPSLFEELAKIEDGPPKLRITGIELPESGfrPYARSNNIGLRLADYAKTFNIPFEYQHISSNKW 544
                      **********************************************************999999************************9999** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      e+l++e+++++++E+l+Vn++++++ l de+ s++s+r++vL++++ ++Pkv+v    + +++ + Fl+rf e +++y +lfd+l++++pr++e
  ORUFI03G25830.1 545 EALSPEDFNIEKDEVLIVNCIYRIKDLGDETISINSARSRVLNTIRMMKPKVFVQGVLNGSYGVPFFLTRFKEVMYHYNSLFDMLDKNIPRDNE 638
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +r+ +Er + +    nv+aceg er+er e+++kW+ r  +aG+ ++pl+  ++ + + ++rk + + + v+ee+++lvlgWk+r L++ S W+
  ORUFI03G25830.1 639 TRMIIERDIYQYIMLNVIACEGPERIERPESYKKWKVRNLKAGLVQLPLNPAIVRETQDMVRKGYHKDFLVDEEDQWLVLGWKGRILYASSTWQ 732
                      ********999999**************************************************9888*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.471334712IPR005202Transcription factor GRAS
PfamPF035145.5E-100360732IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MSASQNLHRL PEFCVIPATA CSREPGLPRI VIRSNMGSDD NKRFDDFHVI TNGPGSDAYS  60
NEESINLDSY IAPSTSFCSK IYNPQLYVEK GNGTTDWCQT SGGDYPEKSS INSDITLSYI  120
DKILMQEDID DRGNEDTALQ AMEEPFYELL GEKYPAFPQQ QPLCVCDHLQ NLSANTDKSN  180
GHACNTWSVT RMTNISSSMN SNGNFQGFQF PWSLSSITRE TEQFTHHSNR MVVGLKVDGL  240
SISEKPSQDN CSLQIDAHYM RKHPLFEVHD RKSYPCIEDL DLLEGRSNKQ YAIYYDEPIR  300
DEMFDNVLLC SDHKPLDEGV SLSRAMTNNS SKSSQIGQGK TSARRKTTGK RIQKRDVVDL  360
RTLLINCAQA VSVSNHSLAS DILKIIRHHA SPTGDDSQRL ALCLAYCLDV RLTGTGSQIY  420
HKFITKRRNV KDILKVFHVC LSTCPFLRAS HYFSNRTIVD VSKGKPQVHI IDFGICFGFQ  480
WPSLFEELAK IEDGPPKLRI TGIELPESGF RPYARSNNIG LRLADYAKTF NIPFEYQHIS  540
SNKWEALSPE DFNIEKDEVL IVNCIYRIKD LGDETISINS ARSRVLNTIR MMKPKVFVQG  600
VLNGSYGVPF FLTRFKEVMY HYNSLFDMLD KNIPRDNETR MIIERDIYQY IMLNVIACEG  660
PERIERPESY KKWKVRNLKA GLVQLPLNPA IVRETQDMVR KGYHKDFLVD EEDQWLVLGW  720
KGRILYASST WQPNDSGDSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-413647328375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630113.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A0E0NXV90.0A0A0E0NXV9_ORYRU; Uncharacterized protein
STRINGBGIOSGA013074-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-146GRAS family protein